DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG7367

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:395 Identity:114/395 - (28%)
Similarity:171/395 - (43%) Gaps:74/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTGMHISHWLLWTCLLLLGAAGTDA--SVDY---FAYAP---GKCEVSISDVIQGMITTEAGVIL 60
            :||......::...|||.|..|..|  ..||   :.|.|   ||.||:               .|
  Fly    31 ITGFAALAQVVRPVLLLFGIRGEVALNQEDYNKTWIYMPNGQGKPEVA---------------YL 80

  Fly    61 GRPRPSQ----TKLLRYDLY-----------TPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSI 110
            ..|.|..    .:|::::||           ...|..|.......|........|||:...::.:
  Fly    81 VEPPPENRINLPQLIKFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILV 145

  Fly   111 HGWAGKSVTCSNA--AIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLH 173
            |||  ||.|.||:  :|:.||:.||..||..::|..|:.:|.|...::....:...|||::..|.
  Fly   146 HGW--KSSTMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLV 208

  Fly   174 DNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPA-GLTQLSLGPEERLDVNDALYV 237
            :.......:|::||||.|:||.|..|...: :|:..|..|||| ...:..:|||..||..||.:|
  Fly   209 EEKDADPNRIHLIGHSLGAHIMGYAGSYTK-YRVNRITGLDPARPAFEDCIGPENHLDDTDANFV 272

  Fly   238 ESIHTDLTLLG--NPSTKLSHASFFANWGLG--QPHCPNATATEFDFVCDHFAAMFYFAESVRQP 298
            :.||:....||  .|   :....|:.|.| |  ||.|..  .::....|.|..:..|:|||:..|
  Fly   273 DVIHSCAGYLGFRKP---IGMVDFYPNGG-GPPQPGCKE--LSQIFTGCSHGRSYEYYAESINSP 331

  Fly   299 KSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPK--RGIFYLST--RPQSP 359
            |.|..:.||               |.::.....|||.:.:.|:| ||:  ||||::.|  :|...
  Fly   332 KGFYGVPCS---------------GLDELKGKNCTGGKILMGDP-VPREARGIFFVKTANKPSYA 380

  Fly   360 YGTSD 364
            .|..|
  Fly   381 LGIDD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 96/332 (29%)
Pancreat_lipase_like 72..356 CDD:238363 91/305 (30%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 88/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.