DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG14034

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:299 Identity:90/299 - (30%)
Similarity:138/299 - (46%) Gaps:23/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVII 139
            |||..|.|..:|    .:..|....|....|::|.|||:.|......|..::..:|:: :||:|.
  Fly    42 LYTKENQEGTKL----SVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFLTQ-DYNLIS 101

  Fly   140 LDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRP 204
            ||:.:.:.:..|.........:|...|::||.|.::..|..|.:::||...|:|::|..|:.|..
  Fly   102 LDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPE 166

  Fly   205 HRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHASFFANWGLGQPH 269
            |:|..|.|||||....:...|..:||..||.:|:.:|||:|:||.... :.|..|:.|.|:.||:
  Fly   167 HKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDA-VGHVDFYLNMGVSQPN 230

  Fly   270 CPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATC--NCNVGGSEKYAVNTC 332
            |......|..| |.|..|..|:|||:..|..|....|.:.||.....|  :.|:           
  Fly   231 CGPINKMETHF-CYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNI----------- 283

  Fly   333 TGNEFMGGEPAVPKRGIFYLSTRPQSPYGTSDGLVHIKR 371
               |.||.......||.::|.|....||...:....|.|
  Fly   284 ---ELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSISR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 86/286 (30%)
Pancreat_lipase_like 72..356 CDD:238363 86/282 (30%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 85/281 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.