DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG4267

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:289 Identity:99/289 - (34%)
Similarity:150/289 - (51%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLS------RG------NYNVIILDW 142
            ||:..||||.|:.:...|:.||||..:|.......:|:||||      .|      ::|||:.||
  Fly    91 GDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDW 155

  Fly   143 SRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRL 207
            |:.|.:::|..|:|.:..:.|.:|:::|:|:....:.|:.:|:||||.|:.|:|..||.:.|:|.
  Fly   156 SKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRF 220

  Fly   208 GAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTL-LGNPSTKLSHASFFANWGLGQPHCP 271
            ..|:||||||........|.|:|.:||.|||||.|.::. ...|   :.||:|:.|:|..|..| 
  Fly   221 NTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVSFGFEQP---VGHATFYPNYGKNQKKC- 281

  Fly   272 NATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNT----C 332
                  :.:.|.|..:..||.||:..|..|...||                  |::...|    .
  Fly   282 ------YVYGCSHKRSHDYFIESLTSPAGFWGPRC------------------ERHDDGTWLLLM 322

  Fly   333 TGNEF-MGGEPAVPKRGIFYLSTRPQSPY 360
            :..|| |||||::||.|.||:.|..:.||
  Fly   323 SDGEFRMGGEPSIPKNGTFYVKTYSKPPY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 97/287 (34%)
Pancreat_lipase_like 72..356 CDD:238363 97/283 (34%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 97/287 (34%)
Pancreat_lipase_like 71..347 CDD:238363 97/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.