DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG18258

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:329 Identity:91/329 - (27%)
Similarity:133/329 - (40%) Gaps:49/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EAGVILGRPRPSQTK---LLR-----YDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIH 111
            :.||:..:..|..::   |||     .:...||...|:         :...:.|....|..:.|.
  Fly   157 DLGVVRSKLIPDMSRMSFLLRSSDDCQNTSIPLTQAEQ---------LWNTTGFYQDRPTVLFIT 212

  Fly   112 GWAGKSVTCSNAA-IKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDN 175
            ||. .|:..||:. :..|||.|.:.||:||| :...:|..|...:.....|...:||.|  |..|
  Fly   213 GWT-TSINNSNSGPVAKAYLCRNDTNVLILD-AANFIDTLYTWSALNTEVIGDYLAKAL--LRLN 273

  Fly   176 TGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGA------IFALDPAGLTQLSLGPEERLDVNDA 234
            |....:|.:::|||.|:.|:|..|:..|  ||..      |..||||..........|.|...||
  Fly   274 TSYVTKQFHLVGHSLGAQIAGSAGRNYR--RLSGGQILKRITGLDPANPCFYDGNELEGLRSGDA 336

  Fly   235 LYVESIHTDLTLLGNPSTKLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESV--RQ 297
            .:|:.|||:..:.|. |.:...|.||....:  |..|...:.: ...|.|..|:.|:.|:|  ..
  Fly   337 RFVDIIHTNPGMFGT-SKRAGDADFFVQGRI--PFKPGCESLD-PISCSHQRAVDYWTETVYPSN 397

  Fly   298 PKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYGT 362
            ...|.|.||.....:|..          .|..||   |..||........|:||:...|:.|||.
  Fly   398 GNDFLAKRCKRYSELLLG----------NYCKNT---NTVMGYAAKATDLGLFYVGANPEEPYGQ 449

  Fly   363 SDGL 366
            :..|
  Fly   450 NANL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 87/321 (27%)
Pancreat_lipase_like 72..356 CDD:238363 81/297 (27%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 83/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.