DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and Yp1

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:337 Identity:81/337 - (24%)
Similarity:141/337 - (41%) Gaps:60/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GKCEVSISDVIQGMITTEAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNP 102
            |:.||:|  ::.|:..|...|.....:..|..:.||:|     .::||..:.|:......|:...
  Fly   122 GEDEVTI--IVTGLPQTSETVKKATRKLVQAYMQRYNL-----QQQRQHGKNGNQDYQDQSNEQR 179

  Fly   103 KWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSK-QLPSIAANVA 166
            |.....|...::.:        :|:|....|  ::|::|.. ..|: :|.|.:. .:....|.:.
  Fly   180 KNQRTSSEEDYSEE--------VKNAKTQSG--DIIVIDLG-SKLN-TYERYAMLDIEKTGAKIG 232

  Fly   167 KMLRFLHDNTGVPYEQIYMIGHSAGSHISG--------LTGKLLRPHRLGAIFALDPAGLTQLSL 223
            |.:..:.:...:|::.|::||.:.|:|::|        |||     |:|..:..|||:.:...|.
  Fly   233 KWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTG-----HKLRRVTGLDPSKIVAKSK 292

  Fly   224 GPEERLDVNDALYVESIHTDLTLLGNPSTKLSHASFFANW-GLGQPHCPNATATEFDFVCDHFAA 287
            .....|...||.:|::|||.:..:|.| .:.....|:.|. ..|.|...|.....       ..|
  Fly   293 NTLTGLARGDAEFVDAIHTSVYGMGTP-IRSGDVDFYPNGPAAGVPGASNVVEAA-------MRA 349

  Fly   288 MFYFAESVR--QPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNE-FMGGEPAVPKRGI 349
            ..|||||||  ..:||.|:..:|.               ::|..|...|.. :||.:.|....|.
  Fly   350 TRYFAESVRPGNERSFPAVPANSL---------------QQYKQNDGFGKRAYMGIDTAHDLEGD 399

  Fly   350 FYLSTRPQSPYG 361
            :.|...|:||:|
  Fly   400 YILQVNPKSPFG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 74/319 (23%)
Pancreat_lipase_like 72..356 CDD:238363 69/296 (23%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 61/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.