DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG1986

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:413 Identity:100/413 - (24%)
Similarity:147/413 - (35%) Gaps:131/413 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HISHWLLWTCLLLLGAAGTDASVDYFAYAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKLLR 72
            |::|.||..|||.|                      :.||               ||     :..
  Fly     4 HVNHLLLLGCLLCL----------------------LGDV---------------PR-----IEA 26

  Fly    73 YDLYTPLNPEERQLLRPGDLTMLRNS--------------------------HFN---------- 101
            :..::|:....|.|..    ||||||                          |||          
  Fly    27 FHRWSPMMKAFRYLQE----TMLRNSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFR 87

  Fly   102 ---PKWPVRVSIHGWAGKSVTCSNAAIKDAYLS----RGNYNVIILDWSRQSLDISYPRVSKQLP 159
               |...:.:.:|||..:.   |...:::..|:    ..||||.::||...|.: .|...|..:.
  Fly    88 RLDPNKKLALFLHGWNDQG---SKDWVQELLLTWTLFDSNYNVCVVDWGNLSQN-DYKSASMSIF 148

  Fly   160 SIAANVAKMLRFLHDNTGVPYEQ--IYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAG-LTQL 221
            .:...||.::..|.:.....:.:  :.:.|:|.|:|.:|..|.:|. .::..|..||||| |..|
  Fly   149 DVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLE-GQVEQIIGLDPAGPLFSL 212

  Fly   222 --SLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHASFFANWGLG-QPHC---------PNAT 274
              .:.|:.|||..||.:|:.:||....||. |.|..||.|:.|.|.. |.:|         .|..
  Fly   213 PAEVAPKYRLDPGDAQFVQVLHTSGGSLGT-SLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTN 276

  Fly   275 ATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNE--F 337
            ...    |.|.||..:|.:|:.....|....|               |...::|...|.||.  .
  Fly   277 PVS----CSHSAAAIFFRQSMDPEYPFVGYEC---------------GSYREFAAGYCDGNRKAR 322

  Fly   338 MGGEPAVPKRGIFYLSTRPQSPY 360
            .|.......:|.||..|.||.||
  Fly   323 FGIHSQRRAQGSFYFRTAPQQPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 88/366 (24%)
Pancreat_lipase_like 72..356 CDD:238363 84/343 (24%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 75/298 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.