DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and lpl

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:364 Identity:89/364 - (24%)
Similarity:149/364 - (40%) Gaps:59/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFAYAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKLL--------RYDLYTPLNPEERQ-LL 87
            ||.|.....|.:|....:.:..::   |:|    :.|:.:        ::...|...||:.. .:
Zfish    18 YFVYISSGLETTIDPTAESITLSD---IIG----NATEWMMDFTDIESKFSFRTLEEPEDDLCYI 75

  Fly    88 RPGDLTMLRNSHFNPKWPVRVSIHGW--AGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDIS 150
            .||....:::.:||.:....:.||||  .|...:.....:...|....:.|||::||..::.. .
Zfish    76 VPGQPQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVDWLSRAQQ-H 139

  Fly   151 YPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDP 215
            ||..:.....:..:|||.:.:|......|:|:::::|:|.|:|::|:.| ||..|::..|..:||
Zfish   140 YPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAG-LLTKHKVNRITGMDP 203

  Fly   216 AGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKL------SHASFFANWGLGQPHC---- 270
            ||.|.........|..:||.:|:.:||:..  |:|...:      .|...:.|.|..||.|    
Zfish   204 AGPTFEYADSLSTLSPDDANFVDVLHTNTR--GSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQN 266

  Fly   271 -----PNATATEFDFV--CDHFAAMFYFAES-VRQPKSFAALRCSSAKSVLSATC------NCNV 321
                 ........|.:  |.|..::..|.:| |.|.....|.||||..|.....|      .||.
Zfish   267 TMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNK 331

  Fly   322 GGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY 360
            .|   ||||          :....:....|:.||...||
Zfish   332 VG---YAVN----------KIRTRRSSKMYMKTREMMPY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 82/341 (24%)
Pancreat_lipase_like 72..356 CDD:238363 78/310 (25%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 81/323 (25%)
Pancreat_lipase_like 56..353 CDD:238363 78/313 (25%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.