DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and Pnlip

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:394 Identity:114/394 - (28%)
Similarity:170/394 - (43%) Gaps:90/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLWTCLLLLGA-AGTDASVDYFAYAPGKCEVSISDVIQGMITTEA---GVILGRP------RPSQ 67
            :|||..:|||| ||.:...|..                |..:.:|   |.| .||      .|:|
  Rat     3 MLWTFAVLLGAVAGKEVCFDKL----------------GCFSDDAPWSGTI-DRPLKALPWSPAQ 50

  Fly    68 TKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGK------SVTCSNAAIK 126
            .. .|:.|||..|.:..|.: ..|.:.:|||:|......|:.|||:..|      |..|.|    
  Rat    51 IN-TRFLLYTNENQDNYQKI-TSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKN---- 109

  Fly   127 DAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAG 191
              .....:.|.|.:||...| ..:|.:.::.:..:.|.||.::..|..:.|...:.:::||||.|
  Rat   110 --MFKVESVNCICVDWKGGS-RATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLG 171

  Fly   192 SHISGLTGKLLRPH-RLGAIFALDPA-----GLTQLSLGPEE-RLDVNDALYVESIHTD----LT 245
            ||::|..||  |.. .:|.|..||.|     |.      ||| |||..||.:|::||||    :.
  Rat   172 SHVAGEAGK--RTFGAIGRITGLDAAEPYFQGT------PEEVRLDPTDAQFVDAIHTDAAPIIP 228

  Fly   246 LLG-NPSTKLSHASFFANWGLGQPHCPNATATEF-----------DF-VCDHFAAMFYFAESVRQ 297
            .|| ..|..:.|..||.|.|:..|.|.....::.           || .|:|..:..|:.:|:..
  Rat   229 NLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVN 293

  Fly   298 PKSFAALRCSSAKSVLSATCNCNVGGSE------KYAVNTCTGNEFMGGEPAVPKRGIFYLSTRP 356
            |..|:...||| .:|.||. .|...|||      .||      :::.|....:.::  |||:|..
  Rat   294 PTGFSGFSCSS-YNVFSAN-KCFPCGSEGCPQMGHYA------DKYPGKTKELYQK--FYLNTGD 348

  Fly   357 QSPY 360
            :|.:
  Rat   349 KSNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 103/351 (29%)
Pancreat_lipase_like 72..356 CDD:238363 95/319 (30%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 105/378 (28%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.