DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and LIPH

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:326 Identity:96/326 - (29%)
Similarity:145/326 - (44%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSQTKL------------LRYDLYTPLNPEERQLLRP---GDLTMLRNSHFNPKWPVRVSIHGW- 113
            ||.|:|            :|..|||..|....|.:..   |:|.:.:.:.|        .:||: 
Human    23 PSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKTTF--------IVHGFR 79

  Fly   114 -AGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDN-- 175
             .|......:..:| ..||..:.||:::||:|.:..:.|...|    |....||.:|:...|.  
Human    80 PTGSPPVWMDDLVK-GLLSVEDMNVVVVDWNRGATTLIYTHAS----SKTRKVAMVLKEFIDQML 139

  Fly   176 -TGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVES 239
             .|...:.|||||.|.|:||||..|::. ...||.|..|||||........::|||.:||.:|:.
Human   140 AEGASLDDIYMIGVSLGAHISGFVGEMY-DGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDV 203

  Fly   240 IHTDLTLLGNPSTKLSHASFFANWGLGQPHCPNATATEFD-FVCDHFAAMFYFAESVRQPKSFAA 303
            ||:|...||. ...|.:..|:.|.||.||.||......|. |.|||..:::.:..|:|:..:..|
Human   204 IHSDTDALGY-KEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITA 267

  Fly   304 LRCSSAKSVLSATC-NCNVGGSEK--------YAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSP 359
            ..|.|.:...:..| :|  |.|:|        ||.|  ..:...|.:|.:.|.   :..|..:||
Human   268 YPCDSYQDYRNGKCVSC--GTSQKESCPLLGYYADN--WKDHLRGKDPPMTKA---FFDTAEESP 325

  Fly   360 Y 360
            :
Human   326 F 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 95/324 (29%)
Pancreat_lipase_like 72..356 CDD:238363 90/301 (30%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 86/282 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.