DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:413 Identity:108/413 - (26%)
Similarity:158/413 - (38%) Gaps:95/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFAYAPGK--CEVSISDVIQGM-----ITTEAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRP 89
            :|..:.||  |...:.....|:     .:||   ::|.|...:....|:.|||..||...|.:..
Human    11 FFGTSRGKEVCYERLGCFKDGLPWTRTFSTE---LVGLPWSPEKINTRFLLYTIHNPNAYQEISA 72

  Fly    90 GDLTMLRNSHFNPKWPVRVSIHGWA--GK--SVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDIS 150
            .:.:.::.|:|......|::|.||.  ||  ...|      :..|...:.|.|.|||...|.:  
Human    73 VNSSTIQASYFGTDKITRINIAGWKTDGKWQRDMC------NVLLQLEDINCINLDWINGSRE-- 129

  Fly   151 YPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDP 215
            |......|..:.|.||..:..|.........::::||||.|:|::|..|.  |...||.|..|||
Human   130 YIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGS--RIPGLGRITGLDP 192

  Fly   216 AGLTQLSLGPEERLDVNDALYVESIHTD----LTLLG-NPSTKLSHASFFANWGLGQPHCP---- 271
            ||....:...|.|||.:||.:|:.|||:    |..|| .......|..|:.|.|...|.|.    
Human   193 AGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKHMPGCEDLIT 257

  Fly   272 -------NATATEFD--FVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATC---------- 317
                   ||...|..  |.|:|..:..::|||:..|.:|.|..|.|..|..:..|          
Human   258 PLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRSYTSFKAGNCFFCSKEGCPT 322

  Fly   318 -----------NCNVGGSEKYAVNT----------------CTGNEF--------MGGEPAVPKR 347
                       |....||. |.:||                .:|:|.        :||  ||.|.
Human   323 MGHFADRFHFKNMKTNGSH-YFLNTGSLSPFARWRHKLSVKLSGSEVTQGTVFLRVGG--AVRKT 384

  Fly   348 GIFYLSTRPQSPYGTSDGLVHIK 370
            |.|.:.:....|     |:.:.|
Human   385 GEFAIVSGKLEP-----GMTYTK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 100/373 (27%)
Pancreat_lipase_like 72..356 CDD:238363 96/350 (27%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 94/347 (27%)
Pancreat_lipase_like 52..348 CDD:238363 87/306 (28%)
PLAT_PL 355..467 CDD:238857 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.