DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:310 Identity:81/310 - (26%)
Similarity:130/310 - (41%) Gaps:54/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EERQLLRPGDLTMLRNSHFNPKWPVRVSIHGW--AGKSVTCSNAAIKDAYLSRGNYNVIILDWSR 144
            |:...|.||....:.:.:|.......:.||||  ||...:.....:...|....:.|||::||  
Zfish    53 EDLCYLVPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFESWVYKLVTALYDREPSANVIVVDW-- 115

  Fly   145 QSLDIS---YPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLL--RP 204
              ||.:   ||:.::....:.|:|||.:.:| :....|.|:::::|:|.|:|::|:.|.|.  :.
Zfish   116 --LDRANKHYPKSAENTRLVGADVAKFVNWL-EELDYPLEKVHLLGYSLGAHVAGVAGNLTNNKV 177

  Fly   205 HRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKL------SHASFFANW 263
            ||   |..|||||.:..:.....||..:||.:|:.:||:..  |:|...:      .|...:.|.
Zfish   178 HR---ITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTR--GSPDLSIGIQRPVGHVDIYPNG 237

  Fly   264 GLGQPHCP-----NATAT----EFDFV--CDHFAAMFYFAES-VRQPKSFAALRCSSAKSVLSAT 316
            |..||.|.     ...||    ..|.:  |.|..::..|.:| |.|.....|.||:|..|.....
Zfish   238 GTFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGL 302

  Fly   317 C------NCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY 360
            |      .||..|.....:.:....:             .||.||...|:
Zfish   303 CLSCRKNRCNTLGYNVKKIRSTRSTK-------------MYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 80/308 (26%)
Pancreat_lipase_like 72..356 CDD:238363 79/304 (26%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 81/310 (26%)
Pancreat_lipase_like 39..335 CDD:238363 79/304 (26%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.