DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10185 and crb3

DIOPT Version :9

Sequence 1:NP_650521.1 Gene:CG10185 / 41953 FlyBaseID:FBgn0038397 Length:1732 Species:Drosophila melanogaster
Sequence 2:NP_593710.1 Gene:crb3 / 2542844 PomBaseID:SPAC13G7.08c Length:446 Species:Schizosaccharomyces pombe


Alignment Length:320 Identity:73/320 - (22%)
Similarity:118/320 - (36%) Gaps:104/320 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1137 TGDICWTLVESLPRFENDDKEMLLQLRLDQHDRMLLGTAGKGFVIWDFGSKDKDAAEECRLREGA 1201
            ||.:..|..:|.|. :|.....|..|...||.|..|.       |.:||.:..|.:         
pombe    25 TGTLVSTFRQSSPA-KNATCTTLNHLLSAQHTRPQLN-------IHNFGKEILDQS--------- 72

  Fly  1202 LYLALPHGVRNITTRIMQSNSIMVSSKL--DYAVAGVRK-NLYVWCLQSGQLAKVLDAHFGRIIQ 1263
              :.||..:            |.|.|..  .:..||..| |||:|.|:||.|.....||:     
pombe    73 --IILPEIL------------ICVQSSPCGSWLAAGTEKGNLYIWSLKSGALIYFFRAHY----- 118

  Fly  1264 LEPLTIGNWNN----LVTSSIDRSVKVWNINNIFEKVHVIDRHELQIDDIS------LSEVDMAV 1318
             :||||..::|    |.|:|.|..|..|.|:.:.::....:.....:..||      .|.|.|.:
pombe   119 -QPLTILKFSNDGMVLFTASNDGDVFAWLISTLVDQNSTFETSNSSVKAISHFSGHKRSIVSMEI 182

  Fly  1319 -----------TVTR-SCVGVWETRSGRLLAKLADSPLGAIVTHAEITPDGRYI-ISSETGKFLV 1370
                       |.:. :.:.:|:..:|.||..:|.....:.:|   :.|..|.: :.:|.|  ::
pombe   183 GPGPIVSGRLYTASEDNTIRIWDVSTGNLLTTIALPSTPSCMT---VDPSERVVYVGNEKG--II 242

  Fly  1371 W-----------NRVSEQVVFRDDQPGIQQITLMDYGYKVLTVSVPNINQRDILAAAAGG 1419
            |           |.|.|:          :::|.:|      ..::||         |.||
pombe   243 WIPLYTGSSTFSNNVKEK----------KRVTSVD------NTTIPN---------AIGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10185NP_650521.1 AAA_16 363..488 CDD:289934
WD40 1177..>1379 CDD:225201 54/238 (23%)
WD40 repeat 1214..1256 CDD:293791 14/44 (32%)
WD40 <1216..1380 CDD:295369 48/200 (24%)
WD40 repeat 1261..1300 CDD:293791 12/42 (29%)
WD40 repeat 1306..1341 CDD:293791 10/52 (19%)
WD40 repeat 1348..1393 CDD:293791 10/56 (18%)
crb3NP_593710.1 WD40 repeat 44..74 CDD:293791 10/47 (21%)
CNDH2_C <45..>71 CDD:293463 9/32 (28%)
WD40 <67..358 CDD:225201 58/270 (21%)
WD40 81..355 CDD:295369 54/233 (23%)
WD40 repeat 81..116 CDD:293791 13/34 (38%)
WD40 repeat 122..172 CDD:293791 12/49 (24%)
WD40 repeat 177..216 CDD:293791 7/38 (18%)
WD40 repeat 224..256 CDD:293791 6/36 (17%)
WD40 repeat 299..336 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18763
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.