DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5013 and AT1G79915

DIOPT Version :10

Sequence 1:NP_650520.1 Gene:CG5013 / 41951 FlyBaseID:FBgn0038396 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_683510.4 Gene:AT1G79915 / 844331 AraportID:AT1G79915 Length:312 Species:Arabidopsis thaliana


Alignment Length:181 Identity:45/181 - (24%)
Similarity:70/181 - (38%) Gaps:52/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WPCAPILAHFLWERRQTLA---GKRILELGSGTALPGILAAKCRAQVVLTD-------NC----I 104
            |....:|:.|:..:..|.:   |...||||:||.|.|||.|:....:.|||       ||    .
plant    80 WKAQLVLSEFVLHKICTSSDFHGIVCLELGAGTGLLGILLARVAKAIFLTDHGDEILGNCGKNLE 144

  Fly   105 LPKSLAHIRKSCLANQLQPGVDIDVVGLSW--GLLLNSVFRLPPL------------------DL 149
            |..||.|           |...::|..|:|  ...:.....|.||                  ..
plant   145 LNSSLFH-----------PHTVVNVRELNWMSDWPIQDTHALSPLFMSSYCWNKQDFELVKCSSF 198

  Fly   150 IIAADCFYDPSVFEDIVVTVAFLLER--NAGA-KFIFTYQERSADWSIEAL 197
            |.|||..|.    :|:.:.:..:|.|  :.|. |.::...|:..::|::.|
plant   199 IFAADVIYS----DDLTIALFSMLRRVMSFGCDKVLYLGLEKRYNFSLDDL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5013NP_650520.1 Nnt1 <54..>165 CDD:443104 37/144 (26%)
AT1G79915NP_683510.4 AdoMet_MTases 75..239 CDD:473071 43/173 (25%)

Return to query results.
Submit another query.