DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5013 and Mettl21e

DIOPT Version :10

Sequence 1:NP_650520.1 Gene:CG5013 / 41951 FlyBaseID:FBgn0038396 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_997164.1 Gene:Mettl21e / 403183 MGIID:2685837 Length:244 Species:Mus musculus


Alignment Length:139 Identity:30/139 - (21%)
Similarity:55/139 - (39%) Gaps:27/139 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   684 KVKAILSGGAGGALTERLIDGKTKKVITMDN-----GDEGFMGAKVESIP---NGVAIRKGVIDR 740
            |::.:||   |..::..|.|.:....:..|.     ||.||:..|::.:|   .....|...|||
Mouse    21 KIRDVLS---GDMISPPLGDVRHSAHVGPDGEGDMFGDVGFLRGKLDMLPGLNQAPGSRSHSIDR 82

  Fly   741 IEITLNDAGEPIPHFVEGSIRT---GTEQGVVRIRLENRGILGNIRAKPK-VRMYKDNSSTGVEI 801
               .:::..|     |.|...|   |....:::..:.....:..::..|| .|::.|...|.|  
Mouse    83 ---RMDEIFE-----VSGKSHTYHRGHHNSLLKTTISMPVFMAPVQPPPKPPRLHLDEQPTPV-- 137

  Fly   802 DDHELSENY 810
              |...:|:
Mouse   138 --HHQQQNH 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5013NP_650520.1 Nnt1 <54..>165 CDD:443104
Mettl21eNP_997164.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
AdoMet_MTases 50..216 CDD:473071 23/107 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.