DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG34316

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:108/224 - (48%) Gaps:28/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CVRES-----YEELRPRLMEGIPELYIPAMEPLVVPQVKMDQD-------SGAIYLHSVYRNVKV 103
            ||.|:     .:|.|.|:...||.|.:||::||.:...:.:.:       :|:|      .|.::
  Fly    26 CVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSI------DNFQL 84

  Fly   104 TGISKHTVNELRLEP-SKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNIT 167
            .|:|...|..|.|.| ..||..:::|.|..:.:|.|:.|.|   ...::.|.|||:.:..:.|.:
  Fly    85 HGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKGS---LAYILNLAGDGNAETSITNFS 146

  Fly   168 MRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEV 232
            :   ||  .::....:.|.|::::::..|..:.|:.|||...|: :.|.::..:||....|..:|
  Fly   147 I---LI--SFRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNEMGVELLGDV 205

  Fly   233 RPLMTKALVDILRASVDKLFASFSYDDLL 261
            .......:|..::|:|:.....:|..|::
  Fly   206 WDYEQGTVVSKVQAAVNNFLGQYSLSDII 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 55/224 (25%)
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.