DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG17189

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:137/270 - (50%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTGLLLVLGVVLH----IDWTTAKPPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEG 66
            |.|||::|...|.    :.:.|.|         ||:::.|....|:...|...|.:....:|::|
  Fly     3 LIGLLMLLHAGLQGAQCVAFYTEK---------PSYIESCKIYEPEFTKCSTRSIQAFMNQLVKG 58

  Fly    67 IPEL---YIPAMEPLVVPQVKMDQD-SGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSL 127
            :||:   :.| ::|:...|:...|| |....|.:...::.:.|..|..:.|.::......::..:
  Fly    59 VPEIEESFGP-IDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKI 122

  Fly   128 TFPKLHMESDYSIKVSREGKIMMMPLLGDGH--CKVDLVNITMRTELIGQEYKKNGANFLKINTV 190
            ..|::.::..|.:    .|:|:::||.|:|.  .::|.::|.|.|:.  :.|:|.|..|..:.:|
  Fly   123 YLPQMRIDGHYKM----VGRILLVPLQGNGKIVMEIDDLDILMTTKT--RLYEKGGYTFYNVTSV 181

  Fly   191 KVKYELSDVHIHLDNLFNG-DKALGDRMNEFLNENWKALAEEVRPLMT----KALVDILRASVDK 250
            |||.::..|...||||||| .|.:.|..|:|.|:|||.:.|.:|||:.    :.|:|:|..:...
  Fly   182 KVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFAL 246

  Fly   251 LFASFSYDDL 260
            ..|||..:|:
  Fly   247 FPASFFVEDI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 67/244 (27%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.