DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and to

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:276 Identity:73/276 - (26%)
Similarity:119/276 - (43%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLTGLLLVLGVVLHIDWTTAK-----PPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLM 64
            |.....:||.:::.:|   ||     .|.|..|. ...:|:|       :|...|:       ..
  Fly     2 FAIAFAVVLCLLVSVD---AKFPEDPKPCKYGDG-ECIMKLC-------NTLFSEN-------SA 48

  Fly    65 EGIPELYIPAMEPLVVPQVKMDQDSGA-------------IYLHSVYRNVKVTGI-----SKHTV 111
            ||.|.|.:..::||.|.::.:.|...:             :|.....|.|||.|.     :||.|
  Fly    49 EGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEV 113

  Fly   112 NELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQE 176
            .           |::.||   .:...|:|    :||::::|:.|.|...:.:||:.......|:.
  Fly   114 K-----------IVTKTF---SLVGPYNI----QGKVLILPISGTGQSNMTMVNVRAIVSFSGKP 160

  Fly   177 YKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALV 241
            ..|||..:|.:..:|:..:....|.|..|||||||||||.||.|||||.:|:.:|....:.::..
  Fly   161 LVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFG 225

  Fly   242 DILRASVDKLFASFSY 257
            .:....|..:|:...|
  Fly   226 KLYLGVVKGVFSKLPY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 66/248 (27%)
toNP_001287525.1 JHBP 5..245 CDD:284096 72/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.