DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG11852

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:234 Identity:69/234 - (29%)
Similarity:125/234 - (53%) Gaps:10/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKM-DQDSGAIYL 94
            |...|..|..||..  |....:..|:..:|.....|.|....|.:||.::.:..: |..:|::.|
  Fly    19 ASNFPPELPRCHMG--DTSCIINVSHMLIRQHARTGYPSAGFPQVEPFLIKRFDISDGRTGSLNL 81

  Fly    95 HSVYRNVKVTGISKHTVNE---LRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGD 156
            ...:|:|.|.|:|....:.   ...:|:..||.:..:|||:.::..|    ..:|:|:::|:.||
  Fly    82 KLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLKGKY----VADGRILILPIRGD 142

  Fly   157 GHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFL 221
            |..::.|.|.....:......::||..:|.::.:||..|...::|.|:||||||:|||..:|:||
  Fly   143 GDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALGTNLNQFL 207

  Fly   222 NENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260
            |:||..:..|:.|.:..|:.:|:::.:.:||..|:|:||
  Fly   208 NDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 69/234 (29%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.