DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG15497

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:241 Identity:55/241 - (22%)
Similarity:99/241 - (41%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKM----DQDSGAIYL 94
            |...|..||.:..|.:.|:|:.:.:||.....|:|:..|...:|.....|::    .|..|:..|
  Fly    39 LKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRRGESQGLGSFRL 103

  Fly    95 HSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHC 159
              :.|||...|.::..|.:...:|...:.:.:..||...:|.:|..    ..|::...:...||.
  Fly   104 --ILRNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEF----AAKMLGTEMNRKGHW 162

  Fly   160 KVDLVNITMRTEL--IGQEYKKNGANFLKINTVKVKYE---LSDVHIHLDNLFNGDKALGDRMNE 219
            .:.|.:.:..|.:  ||      |...|    :||..|   :..:.:|::||..| :.|....:.
  Fly   163 NLTLYDYSQTTSVRRIG------GPGSL----IKVHVEVDRIGGMELHIENLLQG-QPLNQLADG 216

  Fly   220 FLNENWKALAEEVRP----LMTKALVDILRASVDKLFASFSYDDLL 261
            .:|..|:.....::|    |::.|..||...|    |..|..:..|
  Fly   217 VINSMWQLGLPFIKPMINELVSTAFTDIFNES----FRHFPLEKFL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 55/241 (23%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 54/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.