DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG17279

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:241 Identity:59/241 - (24%)
Similarity:117/241 - (48%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAM-----EPLVVPQVKMDQ 87
            |....|||..::.|  .|.| ..|:.|:...:.....:|:|.:.:.|:     |.:||.:::.| 
  Fly    13 APSLGQLPPEIEKC--RAGD-SICIAETVTRILRLYPKGLPSIGLVALDSIGFEDVVVSRLEPD- 73

  Fly    88 DSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFILSLT--FPKLHMESDYSIKVSREGKIMM 150
              |:......:.|:.|.|.:..||.|.:...:.|..:|.|:  .|.|.:...|.::    |.::.
  Fly    74 --GSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMR----GSLLT 132

  Fly   151 MPLLGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALG 214
            ||:.|.|..||::....:|.:: :.::.:.:|..:..|:.||...::..:|::|:||||..: :.
  Fly   133 MPIHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPE-MS 196

  Fly   215 DRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260
            |.||...|..|..:...:|..:|.|:..::.:.:.::.....||||
  Fly   197 DAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/241 (24%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 59/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.