DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG31189

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:237 Identity:61/237 - (25%)
Similarity:111/237 - (46%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVP-QVKMDQDS-GAIYLHS 96
            ||..::.||...   .||:..|...|.....:||||:.:|.::....| .|.|:..| |.|::..
  Fly    23 LPEDVEKCHFGD---STCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMESPSRGPIWMDF 84

  Fly    97 VYRNVKVTGISKHTVNELR---LEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGH 158
            ..|:....|.:..|:..:.   .||::.:.:|.:..|:|..|:.|.:    .|::::......|.
  Fly    85 RMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDM----SGRVLLFFFNTTGR 145

  Fly   159 CKVDLVN--ITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFL 221
            ...|..|  ||:..:.: .|| :|...:|||..:....:|....|.||.|:..:..:...||:..
  Fly   146 LISDFQNFRITLTIKAL-VEY-RNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDVTIFMNKLF 208

  Fly   222 NENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL-LP 262
            ||||.....:::|.:.||..:.....::::|.:.:|||: ||
  Fly   209 NENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFLP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/235 (25%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 59/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470419
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.