DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG1124

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:216 Identity:61/216 - (28%)
Similarity:109/216 - (50%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSV 97
            :.|.::|.||||.|.|..|...:.|.|:|.|..|||::.:|::||..:..:.:....|.......
  Fly    20 ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKIT 84

  Fly    98 YRNVKVTGISKHTVNELRL----EPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDG- 157
            .:|::..|.|...|..|:|    ||.|.|.::    |||.:|:.|    :..|.::::|..|.| 
  Fly    85 LKNMEAFGASNFKVTSLKLSEGSEPFKAKIVM----PKLKIEAKY----TSSGVLLILPASGGGD 141

  Fly   158 -HCKVDLV--NITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNE 219
             |...:.|  ::|.:|.:    :...|||:|.|:.:.:..::.||.:.:...||.::.|.:..|.
  Fly   142 FHANFEGVSADLTGKTSI----HAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATNL 202

  Fly   220 FLNENWKALAEEVRPLMTKAL 240
            ||.||.:.:.|.::..:.|.|
  Fly   203 FLRENSQVVLEAMQAQLQKKL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 61/216 (28%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 61/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.