DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG2016

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:239 Identity:60/239 - (25%)
Similarity:124/239 - (51%) Gaps:18/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95
            |.:.|.:|:.|.|:...::.|:|||..:|...|.:|:|||.|..:||:::.::.:...||.....
  Fly    19 AQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYR 83

  Fly    96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYS-----IKVSREGKIMMMPLLG 155
            :::||::..|:|..||..:|.:...|:|.|:...|::.:::.|.     |.|...|       .|
  Fly    84 ALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASG-------AG 141

  Fly   156 DGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKAL-----GD 215
            |...:.:.|...:..:.:..| ..:|..:|..::||:.:.:.::.:.:||:.||:..:     ..
  Fly   142 DYWGEYEGVKAKIYFKAVANE-GPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGNTVILLSSTEA 205

  Fly   216 RMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDD 259
            .:|.|:|.|.:.|.:|::|.:...|..::|..:|::||....|:
  Fly   206 ALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 60/239 (25%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.