DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and CG31207

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:248 Identity:55/248 - (22%)
Similarity:97/248 - (39%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDS--GAIYL-- 94
            ||..:|.|....   ..|:..|...:.....:|||.:.:..::.:.:...|...|:  ||.:|  
  Fly    22 LPKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNF 83

  Fly    95 ------HSVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPL 153
                  :..:.|..:|.:|....|     |:.....:....|.|..:.||    ...|::.::.:
  Fly    84 DLFNQVNYGFENTTITKVSGFDEN-----PTSSLIEIHGRIPSLIHKGDY----FSMGRVWIVQM 139

  Fly   154 LGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELS-----DVHIH-LDNLFNGDK 211
            ...|....|..|.....:| :..|| :|...:|||      |||:     |..:. |||.|..:.
  Fly   140 NSTGESLSDFQNFRFVLKLKVIMEY-RNNKRYLKI------YELTPFVTMDRWVFWLDNFFESNT 197

  Fly   212 ALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL-LPM 263
            .:...:|:..|.:|.....|:.|...|....:.|:..:.:|....|||: ||:
  Fly   198 DMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFLPI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 53/245 (22%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 53/244 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.