DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10407 and dyw

DIOPT Version :9

Sequence 1:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:119/266 - (44%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTGLLLVLGVVLHIDWTTAKPPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPEL 70
            |||..:.|..|..:.|.:.:..|  ::..||.||.|....   ::|:....:........||||.
  Fly     3 LTGASMFLVWVGLLSWVSCRVDA--SEGFPSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIPER 62

  Fly    71 YIPAMEPLVV-----------PQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKFI 124
            .:.|:||:.:           ..:|.........|:::..::.|..:...|.:..|    .||..
  Fly    63 QVAALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTR----PLKLT 123

  Fly   125 LSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKK-NGANFLKIN 188
            |.|..|:|.:.:.|.:    :||::::|::..|...:.|.::..:..:..:..|: :|..:|.|.
  Fly   124 LLLDNPELEVRAKYDV----DGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNIT 184

  Fly   189 TVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFA 253
            ..|...::...|..|.||||.:|.|.|...:.||:.|..||.:|:|.:.:|......|.|..|:|
  Fly   185 DYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWA 249

  Fly   254 SFSYDD 259
            :..||:
  Fly   250 NIPYDE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/244 (24%)
dywNP_570016.1 JHBP 29..258 CDD:214779 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.