DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG17189

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:119/236 - (50%) Gaps:16/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSF---EPLNIDQVSVSKGSGNL-V 103
            |:||::::||...|...||..:..:.....|..|:||| .:||   :|:..:|:...:.:.:: .
  Fly    25 EKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEI-EESFGPIDPMRQEQLVFKQDNSDVAT 88

  Fly   104 LSGGFQDLVIRGPSNATVRRASLDLERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMA 168
            ||....|::|||.....::.:.:..:......::.||::||...|.:.|.|||:||.|:|.:.|.
  Fly    89 LSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKIVME 153

  Fly   169 LKNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNG-NEILAASINSFLNQN 232
            :.::...:.|:..|..  :.|....::..:||..|||.:|..|.||||| ::.:..|.|.|.|.|
  Fly   154 IDDLDILMTTKTRLYE--KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDN 216

  Fly   233 GKEVIAELRP----DLELGLADIFHGLWNNVFSKMPTKLWL 269
            .|:|...|||    .:|..|.|:.|    ..|:..|...::
  Fly   217 WKDVFEALRPLVVETVERTLLDLLH----KTFALFPASFFV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 68/236 (29%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.