DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG14259

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:273 Identity:69/273 - (25%)
Similarity:136/273 - (49%) Gaps:13/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STTYWK--LAVSLSVFGSICLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLF 66
            ||.|.:  |.:...:...:||..:   |..|.:|:......|:|::|.:|:...|...||.....
  Fly     3 STRYGRTLLGIWSGLLAILCLNEI---AMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSI 64

  Fly    67 EGCFPALAAGIPEIGVK--SFEPLNIDQVSVSKGSGNLV--LSGGFQDLVIRGPSNATVRRASLD 127
            :.....|..||||:..:  .|:|:.:..: |.|...|.|  :.....|||::|.:|..|:.:.:.
  Fly    65 QKLLDQLNIGIPEVLERFGPFDPMRVRDI-VFKQDNNEVATIRANLTDLVVKGFANTKVKESRVS 128

  Fly   128 LERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEI 192
            .:......::.||::|:..:|.:.|.|||:||.|||.:.:.:.::...:.|:|.|..  :.|...
  Fly   129 KKDFSWQTKIYLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYE--KGGFTF 191

  Fly   193 IHIDEMKVGFDVGAMRIHLKNLFNG-NEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLW 256
            .::..::|..::..:|.:|.||||| ::.:..|.|.|.|:|.::....|:|.:...:.:|.:.:.
  Fly   192 DNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVM 256

  Fly   257 NNVFSKMPTKLWL 269
            :.||..:|...::
  Fly   257 STVFHLIPANFFV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 60/233 (26%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.