DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG14258

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:117/260 - (45%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLAVSLSVFGSICLITVTHGA-YTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPA 72
            |:|..||:..  .|::...|| |          |.|:|.:|..|...:||.:.|..:.|:..|..
  Fly     4 KVAKFLSIVA--VLLSAVEGAKY----------LAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQ 56

  Fly    73 LAAGIPEI-GVKSFEPLNIDQVSVSK-GSGNLVLSGGFQDLVIRGPSNATVRRASLDLERRLLNF 135
            ...|||.. .|.||:|..|.:|..:: .|.::.::...:::.:.|...|.|..:|.|....:...
  Fly    57 WKDGIPGYNAVGSFDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVART 121

  Fly   136 ELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHIDEMKV 200
            .:.:|:||....|.:||::..|.|.|.|......:|  ..:...::::....:......:..:||
  Fly   122 LISVPKLRFNFDYKVKGHVSALNLNGHGKGYFEAEN--ALLLLELAVKPLATSDGYFADVQSVKV 184

  Fly   201 GF-DVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSKMP 264
            .| ::...||.|:|||.||:.|..:.:...|:|.::....|||.:|..:..:....:...|..:|
  Fly   185 NFREIKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVP 249

  Fly   265  264
              Fly   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 55/226 (24%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.