DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and to

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:124/266 - (46%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVSLSVFGSICLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAA 75
            |::.:|.  :||:.         .|:.|.|...:|     ||.   .:.:|..:|....|...:|
  Fly     3 AIAFAVV--LCLLV---------SVDAKFPEDPKP-----CKY---GDGECIMKLCNTLFSENSA 48

  Fly    76 -GIPEIGVKSFEPLNIDQVSVSKG--SGNLVLSGGFQDLVIRGPSN---ATVRRASLDL----ER 130
             |.|.:.:...:||.:|::.:|:|  |..:.::..|.|.::.|..:   ..|:....||    |.
  Fly    49 EGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEV 113

  Fly   131 RLL--NFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEII 193
            :::  .|.|..|       ||::|.:|:||:.|:|...|.:.||...|  ..|.:...:.|:..:
  Fly   114 KIVTKTFSLVGP-------YNIQGKVLILPISGTGQSNMTMVNVRAIV--SFSGKPLVKNGETYL 169

  Fly   194 HIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNN 258
            .:.::|:.....:...|..|||||::.|..::|.|||:|.:.:..|....::.....::.|:...
  Fly   170 DVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKG 234

  Fly   259 VFSKMP 264
            ||||:|
  Fly   235 VFSKLP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 59/235 (25%)
toNP_001287525.1 JHBP 5..245 CDD:284096 65/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.