DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG7079

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:267 Identity:60/267 - (22%)
Similarity:105/267 - (39%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSLSVFGSI-CLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAA 75
            :::.:||.: |               .|||.:        .|:.:..:.||..:...........
  Fly     9 ITIQLFGGLQC---------------QKLPAK--------VKKCHFGDGKCLVESANALLRDFPK 50

  Fly    76 GIPEIGVKSFEPLNIDQ---VSVSKGSG-----NLV--LSGGFQDLVIRGPSNATVRRASLDLER 130
            ||||:.:|.|..|::..   |:.|:..|     ||:  ::.||::..|     ..:|....|...
  Fly    51 GIPEVDLKPFNVLSVRDWLLVNDSQVGGAWYYFNLINQINYGFENTTI-----TEIRGFDKDPTT 110

  Fly   131 RLLNFELELPRLRIRAKYNLKGNIL-LLPLVGSGDVAMALKNVH--TTVYTRISLRNETRTGDEI 192
            ..:....::|||..:..|..||.:| .:.:...|.......|..  .|:..|:..||..|    .
  Fly   111 TKIEIHGKIPRLVYKGDYVAKGRMLWFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKR----Y 171

  Fly   193 IHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWN 257
            :.|.|:.....:....:.|.|.|..||.|..::|:..|:|..|...||.|.:......:|..|:.
  Fly   172 LKIYELVPNIRLDRWIMWLDNFFPDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFE 236

  Fly   258 NVFSKMP 264
            ::|.|:|
  Fly   237 DLFEKVP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 54/236 (23%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.