DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG31189

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:195 Identity:50/195 - (25%)
Similarity:86/195 - (44%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GIPEIGVKSFEPLNI-DQVSV-SKGSGNLVLSGGFQDLVIRGPSNATVRRAS---LDLERRLLNF 135
            ||||||:...:..|. |.|.: |...|.:.:....:|.|.:|.:|||:....   .:..::.:..
  Fly    52 GIPEIGLPPLDAYNFPDSVIMESPSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVL 116

  Fly   136 ELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKN--VHTTVYTRISLRNETRTGDEIIHIDEM 198
            ::.||||...|.|::.|.:||.....:|.:....:|  :..|:...:..||:.|    .:.|..:
  Fly   117 KVRLPRLVHEATYDMSGRVLLFFFNTTGRLISDFQNFRITLTIKALVEYRNDKR----YLKIYNL 177

  Fly   199 KVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSKM 263
            ....|:....|.|..|:..|..:...:|...|:|..|...:|:|.|.....:.|..|.|.||..:
  Fly   178 VPSLDLDRWIIWLDGLYKENTDVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNV 242

  Fly   264  263
              Fly   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 50/195 (26%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 50/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.