DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG2016

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:125/235 - (53%) Gaps:10/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLVLSG 106
            ||:|.:||.|.|.....::|.|:........|..|:||:.:...||:.||::.:..|||......
  Fly    20 QEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYRA 84

  Fly   107 GFQDLVIRGPSNATVRRASLDLERRLLNFEL--ELPRLRIRAKYNLKGNILLLPLVGSGDVAMAL 169
            .|:::...|.||.||.....||:.  |.|:|  |:||:|::|:|...|.::|:...|:||.....
  Fly    85 LFRNIQAYGVSNITVTNIRSDLDS--LQFQLTCEIPRIRVKAQYRSTGVLILVKASGAGDYWGEY 147

  Fly   170 KNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEIL-----AASINSFL 229
            :.|...:|.: ::.||...|...:..|.:|:.|:|..:::.:.|:.|||.::     .|::|.|:
  Fly   148 EGVKAKIYFK-AVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGNTVILLSSTEAALNLFI 211

  Fly   230 NQNGKEVIAELRPDLELGLADIFHGLWNNVFSKMPTKLWL 269
            |.|.:|::.|::|.|...|..:.....:.:|:|:|...|:
  Fly   212 NSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 69/235 (29%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470461
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.