DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG16820

DIOPT Version :9

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:255 Identity:51/255 - (20%)
Similarity:106/255 - (41%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALA-AGIPEIGVKSFE 86
            :|::.|:      |:..|          |..::|:.::|.|.|.:...|.|. .|:||..:.|.:
  Fly    76 VTLSSGS------NEVTP----------CSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSID 124

  Fly    87 PL----NIDQVSVSKGSGNLVLSGGFQDLVIRGPSNATVRRASLDLERR--LLNFELELPRLRIR 145
            |.    .|.:.:.....|.|::    :::.|.|.|...|...:.:....  ::...:|||:|:..
  Fly   125 PYFYKRGIFRYTNDGIQGGLLI----KNMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAG 185

  Fly   146 AKYNLKGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIH 210
            ..:........|.||..|...:.:.|:..|:.|...: .:..:|.:.:.:..:....::|..::.
  Fly   186 GHFKADVKFGGLRLVPKGPFNITIDNIKATILTDGHI-EQLPSGQQRLSLHRLNANVNIGDAKVV 249

  Fly   211 LKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSKMPTKLWLV 270
            ...:|:...:.|..:| .:|:|..|:.....|......|.|.....|..|:|:|.:.:||
  Fly   250 ANGIFSDRNLNAMILN-LVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFLV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 45/234 (19%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/250 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.