DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and GZF3

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_012425.1 Gene:GZF3 / 853334 SGDID:S000003646 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:403 Identity:83/403 - (20%)
Similarity:123/403 - (30%) Gaps:138/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 FHPQVIDEYGSGNMS-----TSHWPP---------ASSIGQYDGSLVTASSTSSPNHELKCENCH 492
            |.|:..:...|.|.|     ...|||         ..|..|...|...||.:::.|.:...::  
Yeast    20 FEPKSSENLNSLNQSEEEGHIGRWPPLGYEAVSAEQKSAVQLRESQAGASISNNMNFKANDKS-- 82

  Fly   493 GPFLRKGSEYFCPNCPAFMRMAPRITQRQAKPKAAAAPNNRRNGVT-------CANCQTNSTTLW 550
              |....:....|:..:...:.|:   .|.|........|..|.|:       |.||.|::|.||
Yeast    83 --FSTSTAGRMSPDTNSLHHILPK---NQVKNNGQTMDANCNNNVSNDANVPVCKNCLTSTTPLW 142

  Fly   551 RRNNEGNPVCNACGLYYKLHNMNRPLSMKKEGIQKRKRKPKNN---------------------- 593
            ||:..|..:||||||:.|||...||:|:|.:.|:.|.||...|                      
Yeast   143 RRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKSRNRKSNTNHAHNLDNFRNQTLIAELKGDCN 207

  Fly   594 ---GGAPMHRA-------PLPSMSQGVNLMA------------NSPLYPSQVPVSMLNSQLNSQQ 636
               .|...:|.       ....:..|.:..|            .|..:.|...:.:|.|...|:.
Yeast   208 IESSGRKANRVTSEDKKKKSSQLLMGTSSTAKISKKPKTESKERSDSHLSATKLEVLMSGDCSRP 272

  Fly   637 NSSPEL----------------------------HDMSTTGQAGGQRVVSISLNATAPPTPDGTL 673
            |..|:|                            |..:...:.......|..|||          
Yeast   273 NLKPKLPKQDTAIYQEKLLTFPSYTDVKEYSNSAHQSAFIKERSQFNAASFPLNA---------- 327

  Fly   674 NMSARHHVTGESHSPYSQQSTPQSQSPHLP---GTVP--------------INRQIVQPVPTIES 721
                       |||..|:......|.|||.   |::.              .|..|.....|:..
Yeast   328 -----------SHSVTSKTGADSPQLPHLSMLLGSLSSTSISNNGSEIVSNCNNGIASTAATLAP 381

  Fly   722 SRSSNTELTPSVI 734
            :.|..|:..||.:
Yeast   382 TSSRTTDSNPSEV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 25/55 (45%)
ZnF_GATA 538..589 CDD:238123 25/57 (44%)
GZF3NP_012425.1 GAT1 4..551 CDD:227928 83/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2600
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 1 1.000 - - mtm9213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.