DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and SRD1

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_009944.2 Gene:SRD1 / 850377 SGDID:S000000611 Length:221 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:28/101 - (27%)
Similarity:43/101 - (42%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 NCPAFMRMAPRITQRQAKPKAAAAPNNRR------NG--VTCANCQTNSTTLWRRNNEGN-PVCN 561
            :|......:..||::.:| |..:.|...:      ||  ..|:.|:...|..||...:.| .:|:
Yeast   128 SCAQGTSRSASITKKYSK-KTTSRPKREKRQTILPNGEIKECSKCKDTWTIQWRSGPDQNRELCS 191

  Fly   562 ACGLYYKLHNMNRPLSMKKEGIQKR----KRKPKNN 593
            .|||.|...       :|||..:||    ||..:||
Yeast   192 PCGLAYGKR-------LKKENEKKRQAADKRIDRNN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 16/57 (28%)
ZnF_GATA 538..589 CDD:238123 17/55 (31%)
SRD1NP_009944.2 ZnF_GATA 163..214 CDD:214648 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.