DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and ARR7

DIOPT Version :10

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_173339.1 Gene:ARR7 / 838487 AraportID:AT1G19050 Length:206 Species:Arabidopsis thaliana


Alignment Length:128 Identity:25/128 - (19%)
Similarity:46/128 - (35%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LDKIKLESSNGADQLAQQTAN---------NLDEQQEQQQQHQQQAATSVGVVVQTG-------Q 101
            |..:.|:...||..|.....|         .|......::..:..|...|.||:.:.       |
plant    60 LQYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQ 124

  Fly   102 AGVSEPEEQYVVVPRNQRRILTTAGTLELNEAREGEPSTNA--------SNASSGSASDSHIE 156
            ..:.|..|::::.|.....:......:..|||.|.:..:::        |:.||.|..|:.|:
plant   125 ECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQEDSDTSSSSHDDTSIK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 GAT1 <533..644 CDD:227928
ZnF_GATA 538..589 CDD:238123
ARR7NP_173339.1 REC_typeA_ARR 26..147 CDD:381119 15/86 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.