DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and AT2G07440

DIOPT Version :10

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_178754.1 Gene:AT2G07440 / 815313 AraportID:AT2G07440 Length:136 Species:Arabidopsis thaliana


Alignment Length:52 Identity:13/52 - (25%)
Similarity:21/52 - (40%) Gaps:13/52 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 LVTASSTSSPNHELKCENCHGPFLRKGSEYFCPNCPAFMRMAPRITQRQAKP 524
            :|..||.:.|....:|       |.||:|.|      |::....:...:.||
plant    18 VVIMSSENVPTRISRC-------LEKGAEEF------FLKPVKLVDHTKLKP 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 GAT1 <533..644 CDD:227928
ZnF_GATA 538..589 CDD:238123
AT2G07440NP_178754.1 PLN03029 <9..136 CDD:215544 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.