DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and med-2

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_498497.1 Gene:med-2 / 191706 WormBaseID:WBGene00003181 Length:174 Species:Caenorhabditis elegans


Alignment Length:246 Identity:58/246 - (23%)
Similarity:88/246 - (35%) Gaps:82/246 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 AYAPFPPSSSFSSNSYAATLQQ-GNTIYSVPGTGQFLAKSESGLNQTGLLRQTGPATFQTISFEG 418
            || |:|..:  :.|.:..|.|| |...||.|..|.:                    :|.|     
 Worm     2 AY-PYPVFN--AENVFDNTQQQVGFYDYSTPFNGTY--------------------SFTT----- 38

  Fly   419 GNGIEPLWASPAPPEYQSVQFSNFHPQVIDEYGSGNMSTSHWPPASSIGQYDGSLVTASSTSSPN 483
                          :|.  .::|::..|       |...|::|.|..    ..||..:.:|.|||
 Worm    39 --------------DYS--YYNNYYDYV-------NTYASYYPTAMD----SSSLNISPTTGSPN 76

  Fly   484 HELKCENCHGPFLRKGSEYFCPNCPAFMRMAPRITQRQAKPKAAAAPNNRRN--GVTCANCQTNS 546
                            |.:|    ..|...:...|......:::..|:|..|  ...|:||....
 Worm    77 ----------------SSHF----TTFTHFSTPSTSPSTSTQSSTPPSNSDNKKSFQCSNCSVTE 121

  Fly   547 TTLWR--RNNEGNPVCNACGLYYKLHNMNRPLSMKKEGIQKRKRKPKNNGG 595
            |..||  |:.||.. ||||.:|.:.:|..||::...: .||||.|.:...|
 Worm   122 TIRWRNIRSKEGIQ-CNACFIYQRKYNETRPVTAVNK-YQKRKLKVQETNG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 18/52 (35%)
ZnF_GATA 538..589 CDD:238123 21/52 (40%)
med-2NP_498497.1 ZnF_GATA 113..157 CDD:238123 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.