DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and end-3

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_506480.1 Gene:end-3 / 191631 WormBaseID:WBGene00001311 Length:242 Species:Caenorhabditis elegans


Alignment Length:264 Identity:54/264 - (20%)
Similarity:89/264 - (33%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 SNSYAATLQQGNTIYSVP-GTGQFLAKSESGLNQTGLLRQTGPATFQTISFEGGNGIEPLWASPA 430
            |||::::....|:..|.. |..||  ..:...|:.|                        :.:|:
 Worm     3 SNSFSSSSSSSNSPMSFDFGFPQF--PEQVQFNEEG------------------------YGTPS 41

  Fly   431 PPEYQSVQFSNFHPQ--VIDEYGSG---NMSTSHWPPASSIGQYDGSLV---------------- 474
            |...|::.:.::..|  ..:.|..|   :|..:...|.:..|.|:.:..                
 Worm    42 PDVLQNMNYHHYPAQDMTTNSYNGGYDNSMQQNFMQPDNGAGYYNENYQQMPDFQFPVQNFDFTN 106

  Fly   475 ----------TASSTSSPNHELKCENCHGPFLRKGSEYFCPNCP--AFMRMAPRITQRQAKPKAA 527
                      ...|.:|.||.....|          |...|..|  ......|....::.||...
 Worm   107 QFEFTTPINDLQQSQTSINHTNPDNN----------ENSMPEIPIDGGFNFFPAQEVQEWKPARK 161

  Fly   528 AAPNNRRN------GVTCANCQTNSTTLWRRNNEGNPVCNACGLYYKLHNMNRPLSMKKEGIQKR 586
            |:.|..:.      ..:|:||....|.|||||.:|...||.|.||.::....||..:..:...||
 Worm   162 ASKNKIKKISTMHINSSCSNCGCRETKLWRRNEQGETECNPCNLYERVKGHKRPQHLWNKPAAKR 226

  Fly   587 KRKP 590
            :|:|
 Worm   227 RRRP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 17/54 (31%)
ZnF_GATA 538..589 CDD:238123 19/50 (38%)
end-3NP_506480.1 ZnF_GATA 178..229 CDD:238123 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2600
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.