DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and elt-4

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001257105.1 Gene:elt-4 / 181249 WormBaseID:WBGene00001252 Length:72 Species:Caenorhabditis elegans


Alignment Length:63 Identity:32/63 - (50%)
Similarity:41/63 - (65%) Gaps:9/63 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 NRRNGVTCANCQTNSTTLWRRNNEGNPVCNACGLYYKLHNMNRPLSMKKE---------GIQK 585
            :.|..:.|:||...:||||||..||:|||||||||:|||::.||:.|||.         ||.|
 Worm     9 SHRKRLVCSNCNGTNTTLWRRKAEGDPVCNACGLYFKLHHVTRPIPMKKNKKHAVLPAPGISK 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 29/57 (51%)
ZnF_GATA 538..589 CDD:238123 31/57 (54%)
elt-4NP_001257105.1 ZnF_GATA 15..59 CDD:238123 28/43 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.