powered by:
Protein Alignment GATAe and elt-4
DIOPT Version :9
Sequence 1: | NP_650516.2 |
Gene: | GATAe / 41945 |
FlyBaseID: | FBgn0038391 |
Length: | 746 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257105.1 |
Gene: | elt-4 / 181249 |
WormBaseID: | WBGene00001252 |
Length: | 72 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 32/63 - (50%) |
Similarity: | 41/63 - (65%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 532 NRRNGVTCANCQTNSTTLWRRNNEGNPVCNACGLYYKLHNMNRPLSMKKE---------GIQK 585
:.|..:.|:||...:||||||..||:|||||||||:|||::.||:.|||. ||.|
Worm 9 SHRKRLVCSNCNGTNTTLWRRKAEGDPVCNACGLYFKLHHVTRPIPMKKNKKHAVLPAPGISK 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160156191 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000130 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.