DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and elt-7

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_504283.1 Gene:elt-7 / 178868 WormBaseID:WBGene00015981 Length:198 Species:Caenorhabditis elegans


Alignment Length:188 Identity:54/188 - (28%)
Similarity:78/188 - (41%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 EPLWASPAPPEYQSVQFSN------FHPQVIDEYGSGNMSTSHWPPASSI---GQYDGSLVTASS 478
            ||...||....|...||..      :.||.:......:.||.|:.|..|.   ..|: ..:.:|.
 Worm    20 EPPARSPMEDYYLFNQFQYNQNPYVYPPQPVYYNTWQDASTHHFDPFQSYQIPSPYE-QPIQSSM 83

  Fly   479 TSSPNHEL------------KCENCHGPFLRKGSEYFCPNCPAFMRMAPRITQRQAKPKAAAAPN 531
            .::|...|            |.||....|:.:.|.|        .....|...::.|..|...  
 Worm    84 CTTPLQPLEDSRIIFDESLTKNENEQKSFVEQDSSY--------ESSGNRFGSQKGKKIAKVI-- 138

  Fly   532 NRRNGVTCANCQTNSTTLWRRNNEGNPVCNACGLYYKLHNMNRPLSMKKEGIQKRKRK 589
               ....|::|.|.:|||||:|:|||..||||.|||:.:.:.||||:.|:....|||:
 Worm   139 ---RDACCSHCSTTTTTLWRKNDEGNLECNACNLYYRHNKVKRPLSLCKQKPTTRKRR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 24/48 (50%)
ZnF_GATA 538..589 CDD:238123 26/50 (52%)
elt-7NP_504283.1 ZnF_GATA 139..187 CDD:214648 24/47 (51%)
ZnF_GATA 143..194 CDD:238123 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.