DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAe and ZGLP1

DIOPT Version :9

Sequence 1:NP_650516.2 Gene:GATAe / 41945 FlyBaseID:FBgn0038391 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001096637.1 Gene:ZGLP1 / 100125288 HGNCID:37245 Length:271 Species:Homo sapiens


Alignment Length:181 Identity:42/181 - (23%)
Similarity:58/181 - (32%) Gaps:72/181 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 QTISFEGGNGIEPLWASPAPPE-------------------YQSVQFS-NFHP----QVIDEYGS 452
            ||...:.|..::|.....|||:                   ::.|... ...|    |:|..|..
Human   103 QTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSL 167

  Fly   453 GNMSTSHWPPASSIGQYDGSLVTASSTSSPNHELKCENCHGPFLRKGSEYFCPNCPAFMRMAPRI 517
            ...|.|...||.::|                         ||....|.                 
Human   168 PCSSRSQESPADAVG-------------------------GPAAHPGG----------------- 190

  Fly   518 TQRQAKPKAAAAPNNRRNGVTCANCQTNSTTLWRRNNEGNPVCNACGLYYK 568
            |:..:....|..|  ||    ||:|:|..|.|||...:|.|:|||||:.||
Human   191 TEAHSAGSEALEP--RR----CASCRTQRTPLWRDAEDGTPLCNACGIRYK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAeNP_650516.2 ZnF_GATA 534..583 CDD:214648 18/35 (51%)
ZnF_GATA 538..589 CDD:238123 17/31 (55%)
ZGLP1NP_001096637.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..141 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 9/70 (13%)
ZnF_GATA 202..>240 CDD:214648 20/40 (50%)
GATA 206..240 CDD:278735 17/30 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.