DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and DAL80

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_012959.1 Gene:DAL80 / 853904 SGDID:S000001742 Length:269 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:69/259 - (26%)
Similarity:113/259 - (43%) Gaps:75/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   790 SRRLSASKRAGL---------SCSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTMKKD 845
            |..|||:  ||:         :|.||.|..|.||||:..|..:||||||:.|||..|||:::|.|
Yeast    11 SPTLSAA--AGVDDCDGEDHPTCQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPISLKTD 73

  Fly   846 TIQKRKRKPKGTKSEKSKSKS-KNALNAIME---------SGSLVTNCHNVGVVLDSSQMDVNDD 900
            ||:.|.||.....:..:.:.: .|..|.|.:         .|||.||...|.::   .:..|:..
Yeast    74 TIKSRNRKKLNNNNVNTNANTHSNDPNKIFKRKKRLLTTGGGSLPTNNPKVSIL---EKFMVSGS 135

  Fly   901 MKPQLDLKPYNSYSSQPQQQLPQYQQQQQLLMADQHSSAASSPHSMGSTSLSPSAMSHQHQTHPH 965
            :||.|          :|::.:|..::     .:.|....:..|       ..||..::.:|    
Yeast   136 IKPLL----------KPKETVPNTKE-----CSTQRGKFSLDP-------CEPSGKNYLYQ---- 174

  Fly   966 QQQQQQLCSGLDMSPNSNYQMSPL-NMQQHQQQQSCSMQHSPSTPTSIFNTPSP----THQLHN 1024
                   .:|.|:. .||.:::.| |:       |..::.||.:.:::     |    |.:|||
Yeast   175 -------INGSDIY-TSNIELTRLPNL-------STLLEPSPFSDSAV-----PEIELTWKLHN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 26/57 (46%)
ZnF_GATA 802..853 CDD:238123 27/50 (54%)
DAL80NP_012959.1 GAT1 <1..269 CDD:227928 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.