DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and GAT3

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_013113.1 Gene:GAT3 / 850700 SGDID:S000004003 Length:141 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:40/144 - (27%)
Similarity:57/144 - (39%) Gaps:43/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 DFYKPNSFNVGGGGRSKANTSGAASSYSCPGSNATSAATSAVASGTAATAATTLDEHVSRANSRR 792
            |..||:|       ::|.||:...|                 ||....|..|.:.:|        
Yeast    28 DCEKPHS-------QTKINTAKPIS-----------------ASLYVTTNNTAVVQH-------- 60

  Fly   793 LSASKRAGLS--CSNCHTTHTS-LWRRNPAGE-PVCNACGLYY-KLHSVPRPLTMKKDTIQKRKR 852
             :..||.|::  |..|....|| .||..|.|| .:||||||:| |:.     |...||..::...
Yeast    61 -NVQKRKGVTRRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYRKIF-----LVFGKDLAKRYFN 119

  Fly   853 KPKGTKSEKSKSKS 866
            :.||...::...||
Yeast   120 EIKGVSVKRKVPKS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 22/53 (42%)
ZnF_GATA 802..853 CDD:238123 20/55 (36%)
GAT3NP_013113.1 GAT1 <1..>141 CDD:227928 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.