DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and CIL

DIOPT Version :10

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_849445.1 Gene:CIL / 828705 AraportID:AT4G25990 Length:409 Species:Arabidopsis thaliana


Alignment Length:106 Identity:26/106 - (24%)
Similarity:41/106 - (38%) Gaps:35/106 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   999 SCS------MQHSPSTPTSIFNTPSPTHQLHNNNNNNNNSSIFNNNNNNNSSSNENNNKLIQKYL 1057
            ||:      |..||  |::  |||||:..:     :..||..|:.:.....:..:..|   |.|.
plant     3 SCAYSFELEMMKSP--PSN--NTPSPSSTI-----SETNSPPFSISTRRPRTPRKRPN---QTYD 55

  Fly  1058 QAQQLSSS-----------------SNSGSTSDHQLLAQLL 1081
            :|..|.|:                 :|....||:...:|||
plant    56 EAAALLSTAYPKIFSSKKAKTQIFGTNKSPLSDYDEASQLL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 802..853 CDD:238123
CILNP_849445.1 CCT 341..399 CDD:461849
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.