DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and ARR9

DIOPT Version :10

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_191263.1 Gene:ARR9 / 824871 AraportID:AT3G57040 Length:234 Species:Arabidopsis thaliana


Alignment Length:138 Identity:33/138 - (23%)
Similarity:49/138 - (35%) Gaps:40/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GTR--FTTLYDTL-AQSKSSYFLNFIRIDRTSGKIVLLQQRTIRDESGAIFVNRDGRLFAFVL-- 101
            |||  ....|:|: ..||.::.|..||                   :||  |..:.|..|.||  
plant    21 GTRKQAEETYETIPGPSKITFLLQAIR-------------------NGA--VAEEVRQMAAVLLR 64

  Fly   102 QFMRDGKNTVLPK-DKDVLAQLKREADFFGMEVFKYLIQETLVDIEKEQRANTNDIVD--IRNSV 163
            :.:......|.|. ..|:...:|.|           |:....|:.:...|..|.|||.  .||.:
plant    65 RLLSSSFEEVYPSLPVDLQTAIKSE-----------LLLAIQVESQSSMRKKTCDIVAELARNLI 118

  Fly   164 NQIANNTY 171
            :...||.:
plant   119 DDDGNNQW 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 802..853 CDD:238123
ARR9NP_191263.1 PLN03029 1..234 CDD:215544 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.