DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and zglp1

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:XP_021332608.1 Gene:zglp1 / 751739 ZFINID:ZDB-GENE-060825-359 Length:374 Species:Danio rerio


Alignment Length:98 Identity:32/98 - (32%)
Similarity:50/98 - (51%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 GGGRSKANTSGAASSYSCPGSNATSAATSAVASGTAATAATTLDEHVSRANSRRLSASKRAGLSC 803
            |.|||:...:   |:||...|...|..:...:..:|..::::.:|    ::...||.||    .|
Zfish   255 GAGRSRLLIT---SNYSEELSRWRSCRSRCRSLHSAQRSSSSEEE----SDPCSLSGSK----IC 308

  Fly   804 SNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSV 836
            ::|.|..|.|||....|.|:|||||:.||.:.|
Zfish   309 ASCRTRKTPLWRDAEDGTPLCNACGIRYKKYRV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 17/39 (44%)
ZnF_GATA 802..853 CDD:238123 17/35 (49%)
zglp1XP_021332608.1 GATA 308..342 CDD:306763 17/34 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.