DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and med-2

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_498497.1 Gene:med-2 / 191706 WormBaseID:WBGene00003181 Length:174 Species:Caenorhabditis elegans


Alignment Length:134 Identity:36/134 - (26%)
Similarity:57/134 - (42%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   730 YKPNSFNVGGGGRSKANTSGAASSYSCPGSNATSAATSAVASGTAATAATTLDEHVSRANSRRLS 794
            |.|.:.:     .|..|.|....|   |.|:..:..|......|:.:.:|......|.:::::  
 Worm    56 YYPTAMD-----SSSLNISPTTGS---PNSSHFTTFTHFSTPSTSPSTSTQSSTPPSNSDNKK-- 110

  Fly   795 ASKRAGLSCSNCHTTHTSLWRRNPAGEPV-CNACGLYYKLHSVPRPLTMKKDTIQKRKRKPKGTK 858
                 ...||||..|.|..||...:.|.: ||||.:|.:.::..||:| ..:..||||.|.:.|.
 Worm   111 -----SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNETRPVT-AVNKYQKRKLKVQETN 169

  Fly   859 SEKS 862
            ...|
 Worm   170 GVDS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 17/49 (35%)
ZnF_GATA 802..853 CDD:238123 21/51 (41%)
med-2NP_498497.1 ZnF_GATA 113..157 CDD:238123 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.