powered by:
Protein Alignment srp and elt-3
DIOPT Version :9
Sequence 1: | NP_732100.2 |
Gene: | srp / 41944 |
FlyBaseID: | FBgn0003507 |
Length: | 1264 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367208.1 |
Gene: | elt-3 / 181503 |
WormBaseID: | WBGene00001251 |
Length: | 317 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 31/66 - (46%) |
Similarity: | 43/66 - (65%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 803 CSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTMKKDTIQKRKRKPKGTKSEKSKSKSK 867
||||.|..|:|||||..|...||||.||::.::..|||:::||.|.||.|:| ::|...|..:
Worm 244 CSNCKTRETTLWRRNGEGGVECNACNLYFRKNNRKRPLSLRKDGIMKRNRRP---RNESPNSAIR 305
Fly 868 N 868
|
Worm 306 N 306
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000130 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10071 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.