DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment srp and elt-2

DIOPT Version :9

Sequence 1:NP_732100.2 Gene:srp / 41944 FlyBaseID:FBgn0003507 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_509755.2 Gene:elt-2 / 181250 WormBaseID:WBGene00001250 Length:433 Species:Caenorhabditis elegans


Alignment Length:281 Identity:84/281 - (29%)
Similarity:123/281 - (43%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 GGRSKANTSGAASSYSCPGSNATSAATSAV-----ASGTAATAATTLDEHVSRANSRRLSASKRA 799
            ||....|.|...::||.|.:.:||.....:     ...||..|..:..:..|.......|||:|.
 Worm   169 GGMMCVNCSTPKTTYSPPVAYSTSLGQPPILEIPSEQPTAKIAKQSSKKSSSSNRGSNGSASRRQ 233

  Fly   800 GLSCSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTMKKD-TIQKRKRKPK-GTKSEKS 862
            ||.||||:.|:|:|||||..|:|||||||||:|||.:|||.:|||: .:|.||||.| |..|..|
 Worm   234 GLVCSNCNGTNTTLWRRNAEGDPVCNACGLYFKLHHIPRPTSMKKEGALQTRKRKSKSGDSSTPS 298

  Fly   863 KSKSKNALNAIMESGSLVTNCHNVGVVLDSSQMDVNDDMKPQLDLKPYNSYSSQPQQQLPQYQQQ 927
            .|:::.                                       :.:...||..::......::
 Worm   299 TSRARE---------------------------------------RKFERASSSTEKAQRSSNRR 324

  Fly   928 QQLLMADQHSS----AASSPHSMGSTSLSP---SAMSHQHQTHP-HQQQQQQLCSGLDMSPN--- 981
            .....||:..|    ||::...:....|.|   :|::...||:. :.|......:||.|.||   
 Worm   325 AGSAKADRELSTAAVAAATATYVSHADLYPVSSAAVTLPDQTYSNYYQWNTAATAGLMMVPNDQN 389

  Fly   982 -----SNYQ--MSPL-NMQQH 994
                 :|||  :.|. |:|.|
 Worm   390 YVYAATNYQTGLRPADNIQVH 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
srpNP_732100.2 ZnF_GATA 798..847 CDD:214648 33/49 (67%)
ZnF_GATA 802..853 CDD:238123 33/51 (65%)
elt-2NP_509755.2 ZnF_GATA 232..280 CDD:214648 33/47 (70%)
ZnF_GATA 236..288 CDD:238123 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 1 1.000 - - otm14257
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.